PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sp_067210_fxpd.t1
Common NameSOVF_067210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Chenopodioideae; Anserineae; Spinacia
Family GRF
Protein Properties Length: 240aa    MW: 26997.1 Da    PI: 8.8744
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sp_067210_fxpd.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC70.71.8e-2285128144
                WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                        d+epgrCrRtDGKkWRCs+++ +++k+CE+H+hrg+++s+k+ +
  Sp_067210_fxpd.t1  85 DPEPGRCRRTDGKKWRCSKEACSDSKYCEKHMHRGKNKSKKQIQ 128
                        79***************************************976 PP

2QLQ477.7e-171746231
                QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeL 31
                       +FTa+Q+q+L++Q+l +Ky++++ PvPp+L
  Sp_067210_fxpd.t1 17 PFTASQWQELEQQLLTFKYIMSGIPVPPQL 46
                       8****************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.6E-71652IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.0E-121747IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.5591752IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.56385129IPR014977WRC domain
PfamPF088791.8E-1886126IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MMIAGRNSCK SPSSPFPFTA SQWQELEQQL LTFKYIMSGI PVPPQLFSTV LNNPFSSSSS  60
PLFPHQQSLP FGWGCFQVGY GRKIDPEPGR CRRTDGKKWR CSKEACSDSK YCEKHMHRGK  120
NKSKKQIQTT LQSSTTTTTN ETILSATTTT SSPTMNLMKT CVPNSSSVIS CSDSQSNDAS  180
TNNYPYYSNN YPTTFYPFLS PQSSSDSTSF TQSSTQNFNA PHWLLDSDSY DQPKKEMRYF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685313.16e-92PREDICTED: growth-regulating factor 5 isoform X1
SwissprotQ8L8A68e-48GRF5_ARATH; Growth-regulating factor 5
TrEMBLA0A0K9RH581e-178A0A0K9RH58_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-42growth-regulating factor 5